PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 138aa    MW: 14858.9 Da    PI: 5.0054
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004956genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26036.11.8e-113092163
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvy 63
                 +C aCk   r C+++C+++p fpa+ +     +  lF  + +l+l++a ++ e  +  ++ ++
  DCAR_004956 30 KCGACKGASRVCKTECPFRPFFPADTADMAHLISSLFHKKGILRLMNACKTAEEVTSCRTRLF 92
                 5***********************************************999888777766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.61829131IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-93092IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MTTDTTGADL TDPDNEEEEE EIPAAVAVDK CGACKGASRV CKTECPFRPF FPADTADMAH  60
LISSLFHKKG ILRLMNACKT AEEVTSCRTR LFNVAVSLIN GTARTHEAEI SELKELVKTQ  120
AASIGVQSES VRKMLPN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-